Recombinant Human NKG2A & CD94 Heterodimer

Instruction Manual!

Product name:	Recombinant Human NKG2A & CD94 Heterodimer
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human cells
Description	Recombinant Human Human NKG2A & CD94 Heterodimer is produced by our Mammalian expression system and the target gene encoding Arg100-Leu233 & Ser34-Ile179 is expressedwith a 8His & Flag tag at the N-terminus
Names	NKG2A&CD94 Heterodimer; KLRC1&CD94 Heterodimer; CD159A&KLRD1 Heterodimer
Accession #	P26715&Q13241
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLS IDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQC GSSIIYHCKHKL&DYKDDDDKSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISS EQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFP SFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Background	NKG2-A/NKG2-B Type II Integral Membrane Protein contains 1 C-type lectin domain and belongs to the killer cell lectin-like receptor family. The killer cell lectin-like receptor family is a group of transmembrane proteins preferentially expressed in NK cells. Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. CD94 (Cluster of Differentiation 94), also known as killer cell lectin-like receptor subfamily D member 1 (KLRD1), is expressed on the surface of natural killer cells in the innate immune system. CD94 Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. CD94 Can form disulfide-bonded heterodimer with NKG2 family members. The CD94/NKG2 complex, on the surface of natural killer cells interacts with Human Leukocyte Antigen (HLA)-E on target cells.