Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1/ACOX1

Instruction Manual!

Product name:	Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1/ACOX1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, pH7.0, 20% gly, 3mM DTT .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Peroxisomal Acyl-coenzyme A oxidase 1 is produced by our expression system and the target gene encoding Met1-Leu660 is expressed with a 6His tag at the N-terminus.
Names	Peroxisomal acyl-coenzyme A oxidase 1, AOX, Palmitoyl-CoA oxidase, Straight-chain acyl-CoA oxidase, SCOX
Accession #	Q15067
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, pH7.0, 20% gly, 3mM DTT .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPD FQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFKNFVHRGRPEPLDLHLGMFLPT LLHQATAEQQERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKW WPGGLGKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYL KMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIAIRYSA VRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPEL HALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFL MKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAK NLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLY GISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYE NLFEWAKNSPLNKAEVHESYKHLKSLQSKL
Background	Peroxisomal acyl-coenzyme A oxidase 1 is an enzyme belongs to the acyl-CoA oxidase family. It catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It shows highest activity against medium-chain fatty acyl-CoAs and activity decreases with increasing chain length. It donates electrons directly to molecular oxygen, thereby producing hydrogen peroxide. it is involved in the pathway peroxisomal fatty acid beta-oxidation, which is part of Lipid metabolism. Defects in this gene result in pseudoneonatal adrenoleukodystrophy, a disease that is characterized by accumulation of very long chain fatty acids.