Recombinant Human Olfactomedin-4/OLFM4

Instruction Manual!

Product name:	Recombinant Human Olfactomedin-4/OLFM4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Olfactomedin-4 is produced by our Mammalian expression system and the target gene encoding Asp21-Gln510 is expressed with a 10His tag at the C-terminus.
Names	Olfactomedin-4, OLM4, Antiapoptotic protein GW112, G-CSF-stimulated clone 1 protein, hGC-1, hOLfD, OLFM4, GW112
Accession #	Q6UX06
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLFSNFTGSVDDRGTCQC SVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVRIDIMEKDTIS YTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRRE IVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSP QHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNT GNIARVNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKL NDTTLQVLNTWYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQ EKVQSINYNPFDQKLYVYNDGYLLNYDLSVLQKPQGGGGSHHHHHHHHHH
Background	Olfactomedin-4/OLFM4 is a secreted protein which contains one olfactomedin-like domain. OLFM4 is expressed during myeloid lineage development,it strongly expressed in the prostate,small intestine,colon and moderately expressed in the bone marrow and stomach. OLFM4 is an antiapoptotic factor that promotes tumor growth. It expressed at high levels in stomach cancer and colon cancer tissues. it promotes proliferation of pancreatic cancer cells by favoring the transition from the S to G2/M phase. In myeloid leukemic cell lines, OLFM4 inhibits cell growth and induces cell differentiation and apoptosis. Through interaction with cell surface lectins and cadherin, OLFM4 facilitates cell adhesion. It may play a role in the inhibition of EIF4EBP1 phosphorylation/deactivation. Induction of OLFM4 in cancer cells was reported to have a novel antiapoptotic action via binding to the potent apoptosis inducer GRIM-19.