Recombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial/ECH1
| Product name: | Recombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial/ECH1 | 
| Source: | E.coli | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,10% Glycerol,pH 8.0. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | E.coli | 
| Description | Recombinant Human ECH1 is produced by our E.coli expression system and the target gene encoding Thr34-Leu328 is expressed with a 6His tag at the N-terminus. | 
| Names | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial,ECH1,, REF: C1008 | 
| Accession # | Q13011 | 
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,10% Glycerol,pH 8.0. | 
| Shipping | The product is shipped on dry ice/ice packs. | 
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					MGSSHHHHHHSSGLVPRGSHMTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNK RNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYL RDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVG TLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAV QSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
				 | 
| Background | Human delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase(ECH1) is a member of the hydratase/isomerase superfamily and contains a C-terminal peroxisomal targeting sequence and localizes to peroxisomes. ECH1 shows high sequence similarity to enoyl-CoA hydratases of several species, particularly within a conserved domain characteristic of these proteins. The rat orthologlocalizes to the matrix of both the peroxisome and mitochondria.It can isomerize 3-trans, 5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. ECH1 plays an important role in the auxiliary step of the fatty acid beta-oxidation pathway. | 


 


 
              








