Recombinant Human Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b

Instruction Manual!

Product name:	Recombinant Human Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Tumor Necrosis Factor Receptor II is produced by our expression system and the target gene encoding Leu23-Asp257 is expressed with a Fc tag at the C-terminus.
Names	Tumor necrosis factor receptor superfamily member 1B, TNFRSF1B, Tumor necrosis factor receptor 2, TNF-R2, TNF-RII, Tumor necrosis factor receptor type II, p75, p80 TNF-alpha receptor, CD120b
Accession #	P20333
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH4O. Please aliquot the reconstituted solution toPTTLGTIHSPEDVIKALADHHHHHHHHHE
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLW NWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARP GTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLP QPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDIEGRDMDPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK
Background	Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B) is a member of the tumor necrosis factor receptor superfamily. Human TNF RII contains four cysteinerich repeats in its ECD, which shares 58% and 56% amino acid sequence identity with the mouse and rat orthologs, respectively.TNF RII is expressed predominantly on cells of the hematopoietic lineage, such as T and natural killer cells, as well as on endothelial cells, microglia, astrocytes,neurons, oligodendrocytes, cardiac myocytes, thymocytes, and mesenchymal stem cells.TNF RII binds to the membranebound forms of TNFα and Lymphotoxinα/TNFβ;soluble TNF is thought to signal predominately through TNF RI.Soluble TNF RII is believed to inhibit TNF biological activity by binding TNF thereby preventing it from activating membrane TNF receptors.