Recombinant Human Interleukin-13 Receptor Subunit Alpha-1/IL-13RA1

Instruction Manual!

Product name:	Recombinant Human Interleukin-13 Receptor Subunit Alpha-1/IL-13RA1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human cells
Description	Recombinant Human Interleukin-13 Receptor Subunit Alpha-1 is produced by our Mammalian expression system and the target gene encoding Gly22-Thr343 is expressed with a 6His tag at the C-terminus.
Names	Interleukin-13 receptor subunit alpha-1; IL-13 receptor subunit alpha-1; IL-13R subunit alpha-1; IL-13R-alpha-1; IL-13RA1; Cancer/testis antigen 19; CT19; CD213a1; IL13RA1; IL13R; IL13RA
Accession #	P78552
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSI EVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRN TSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPS FNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAK CENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTHHH HHH
Background	Interleukin-13 receptor subunit alpha-1(IL13RA1) is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. The human IL13-Rα1 was originally cloned based on sequence homology to the mouse IL13-Rα1, it share 76% aa sequence identity. Human The IL13-Rα1 cDNA encodes a 427 amino acid (aa) residue precursor protein with a putative 21 aa residue signal peptide, a 324 aa residue extracellular domain, a 23 aa residue transmembrane region and a 59 aa residue cytoplasmic tail. The extracellular domain of IL13-Rα1 is also closely related to that of IL13-Rα2. It binds with low affinity to interleukin-13(IL13). IL13RA1 serves as a primary IL13- binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.