Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein

Instruction Manual!

Product name:	Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human cells
Description	Recombinant Human NKG2-A/NKG2-B Type II Integral Membrane Protein is produced by our Mammalian expression system and the target gene encoding Arg100-Leu233 is expressed with a 8His tag at the N-terminus.
Names	NKG2-A/NKG2-B type II integral membrane protein; CD159 antigen-like family member A; NK cell receptor A; NKG2-A/B-activating NK receptor; CD159a; KLRC1; NKG2A
Accession #	P26715
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLS IDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQC GSSIIYHCKHKL
Background	NKG2-A/NKG2-B Type II Integral Membrane Protein contains 1 C-type lectin domain and belongs to the killer cell lectin-like receptor family. The killer cell lectin-like receptor family is a group of transmembrane proteins preferentially expressed in NK cells. Members of this proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. NKG2 is expressed only in NK-cells, but not in T-cells or B-cells. It has been shown that NKG2 represents a family of related cDNA clones, designated NKG2A, NKG2B, NKG2C, and NKG2D, which encode type 2 integral membrane proteins (extracellular C-terminus) containing a C-type lectin domain. NKG2 plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. NKG2A and NKG2B have been given the designation CD159a in the nomenclature of CD antigens.