Recombinant Human Fc epsilon RII/CD23
| Product name: | Recombinant Human Fc epsilon RII/CD23 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human cells |
| Description | Recombinant Human Low Affinity Fc Epsilon RII is produced by our Mammalian expression system and the target gene encoding Asp48-Ser321 is expressed with a 8His tag at the N-terminus. |
| Names | Low affinity immunoglobulin epsilon Fc receptor; BLAST-2; C-type lectin domain family 4 member J; Fc-epsilon-RII; Immunoglobulin E-binding factor; Lymphocyte IgE receptor; CD23; FCER2; CD23A; CLEC4J; FCE2; IGEBF |
| Accession # | P06734 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
HHHHHHHHDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKS QDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWIN FQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIW VDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAES MGPDSRPDPDGRLPTPSAPLHS
|
| Background | Low affinity immunoglobulin epsilon Fc receptor(CD23) is a secreted and single-pass type II membrane protein which is also exists as a soluble excreted form. There are two forms of CD23: CD23a and CD23b. CD23a is present on follicular B cells, whereas CD23b requires IL-4 to be expressed on T-cells, monocytes, Langerhans cells, eosinophils, and macrophages. Unlike many of the antibody receptors, CD23/FCER2 is a C-type lectin. It is found on mature B cells, activated macrophages, eosinophils, follicular dendritic cells, and platelets. In flow cytometry, CD23/FCER2 is helpful in the differentiation of chronic lymphocytic leukemia (CD23-positive) from mantle cell leukemia (CD23-negative). CD23/FCER2 can also be demonstrated in germinal centre B-cells using immunohistochemistry, but it is not present in the resting cells of the surrounding mantle zone. CD23/FCER2 has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specificantigen). |












