Recombinant Human Fc epsilon RII/CD23

Instruction Manual!

Product name:	Recombinant Human Fc epsilon RII/CD23
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human cells
Description	Recombinant Human Low Affinity Fc Epsilon RII is produced by our Mammalian expression system and the target gene encoding Asp48-Ser321 is expressed with a 8His tag at the N-terminus.
Names	Low affinity immunoglobulin epsilon Fc receptor; BLAST-2; C-type lectin domain family 4 member J; Fc-epsilon-RII; Immunoglobulin E-binding factor; Lymphocyte IgE receptor; CD23; FCER2; CD23A; CLEC4J; FCE2; IGEBF
Accession #	P06734
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HHHHHHHHDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKS QDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWIN FQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIW VDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAES MGPDSRPDPDGRLPTPSAPLHS
Background	Low affinity immunoglobulin epsilon Fc receptor(CD23) is a secreted and single-pass type II membrane protein which is also exists as a soluble excreted form. There are two forms of CD23: CD23a and CD23b. CD23a is present on follicular B cells, whereas CD23b requires IL-4 to be expressed on T-cells, monocytes, Langerhans cells, eosinophils, and macrophages. Unlike many of the antibody receptors, CD23/FCER2 is a C-type lectin. It is found on mature B cells, activated macrophages, eosinophils, follicular dendritic cells, and platelets. In flow cytometry, CD23/FCER2 is helpful in the differentiation of chronic lymphocytic leukemia (CD23-positive) from mantle cell leukemia (CD23-negative). CD23/FCER2 can also be demonstrated in germinal centre B-cells using immunohistochemistry, but it is not present in the resting cells of the surrounding mantle zone. CD23/FCER2 has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specificantigen).