elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8

Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8 Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8

Instruction Manual!

Product name: Recombinant Human V-Set and Ig Domain-Containing Protein 8/VSIG8
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human V-Set and Ig Domain-Containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly263 is expressed with a Fc tag at the C-terminus.
Names V-set and immunoglobulin domain-containing protein 8;VSIG8;C1orf204
Accession # Q5VU13
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRIN HGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMC WTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSIN QGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIGVDDIEGRMDEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK
Background V-set and immunoglobulin domain-containing protein 8(VSIG8) is a single-pass type I membrane protein.The human VSIG8 cDNA encodes 414 amino acids (aa) including a 21 aa signal sequence, a 242 aa extracellular domain (ECD) containing 2 Ig-like V-type (immunoglobulin-like) domains, a 21 aa transmembrane domain and a 130 aa cytoplasmic domain.The funtion of VSIG8 is not clear.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese