Recombinant Human C-C Motif Chemokine 4/CCL4

Instruction Manual!

Product name:	Recombinant Human C-C Motif Chemokine 4/CCL4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human C-C Motif Chemokine 4 is produced by our Mammalian expression system and the target gene encoding Ala24-Asn92 is expressed with a 6His tag at the C-terminus.
Names	C-C Motif Chemokine 4; G-26 T-Lymphocyte-Secreted Protein; HC21; Lymphocyte Activation Gene 1 Protein; LAG-1; MIP-1-Beta(1-69); Macrophage Inflammatory Protein 1-Beta; MIP-1-Beta; PAT 744; Protein H400; SIS-Gamma; Small-Inducible Cytokine A4; T-Cell Activation Protein 2; ACT-2; CCL4; LAG1; MIP1B; SCYA4
Accession #	P13236
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSETWVQEYVYD LELNVDHHHHHH
Background	C-C Motif Chemokine 4 (CCL4) is a secreted protein which belongs to the intercrine beta (chemokine CC) family. CCL4 is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form CCL4 (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. CCL4 (3-69) is also a ligand for CCR1 and CCR2 isoform B.