elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Amyloid-like Protein 1/APLP-1

Recombinant Human Amyloid-like Protein 1/APLP-1 Recombinant Human Amyloid-like Protein 1/APLP-1

Instruction Manual!

Product name: Recombinant Human Amyloid-like Protein 1/APLP-1
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of PBS, 1mM EDTA, pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Amyloid-like Protein 1 is produced by our Mammalian expression system and the target gene encoding Gly42-Pro212 is expressed with a 6His tag at the C-terminus.
Names Amyloid-like protein 1; APLP; APLP-1; C30; APLP1
Accession # P51693
Formulation Lyophilized from a 0.2 μm filtered solution of PBS, 1mM EDTA, pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
GGSPGAAEAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIAR VEQATQAIPMERWCGGSRSGSCAHPHHQVVPFRCLPGEFVSEALLVPEGCRFLHQERMDQCESST RRHQEAQEACSSQGLILHGSGMLLPCGSDRFRGVEYVCCPPHHHHHH
Background Amyloid-like protein 1 (APLP-1) is a member of the highly conserved amyloid precursor protein gene family. APLP1 is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. APLP1, together with APLP2, are important modulators of glucose. APLP1 may also play a role in synaptic maturation during cortical development, and is genetically linked to Alzheimer'sdisease.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese