elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Interleukin-17B/IL-17B

Recombinant Human Interleukin-17B/IL-17B Recombinant Human Interleukin-17B/IL-17B

Instruction Manual!

Product name: Recombinant Human Interleukin-17B/IL-17B
Source:Human Cells
Purity:Greater than 96% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
SourceHuman CellsDescriptionRecombinant Human Interleukin-17B is produced by our Mammalian expression system and the target gene encoding Gln21-Phe180 is expressed with a Fc tag at the C-terminus.Namescytokine Zcyto7;IL-17B; interleukin-17 beta; interleukin-17B;neuronal interleukin-17 related factor; Neuronal interleukin-17-related factor; NIRF; ZCYTO7interleukin-Cytokine Zcyto7; cytokine-like protein ZCYTO7; interleukin-17 beta;interleukin-17B; interleukin 17B; neuronal interleukin-17 related factor; Neuronal interleukin-17-related factor;Accession #Q9UHF5FormulationLyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 96% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCE VNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVR RRLCPPPPRTGPCRQRAVMETIAVGCTCIFDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGK
BackgroundInterleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses and inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E and IL-17F. The six IL-17 cytokines are highly conserved at C terminus, and contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine and chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) and induces the production of inflammatory cytokines and the infiltration of inflammatory immune cells.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese