Recombinant Human CD7/Leu-9

Instruction Manual!

Product name:	Recombinant Human CD7/Leu-9
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human T-Cell Antigen CD7 is produced by our Mammalian expression system and the target gene encoding Ala26-Pro180 is expressed with a Fc tag at the C-terminus.
Names	T-Cell Antigen CD7; GP40; T-Cell Leukemia Antigen; T-Cell Surface Antigen Leu-9; TP41; CD7
Accession #	P09564
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDF SGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAP PTGSALPDPQTASALPDPPAASALPDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK
Background	T-Cell Antigen CD7 is a single-pass type I membrane protein that that belongs to the the immunoglobulin superfamily. Human CD7 is synthesized as a 240 amino acid precursor that contains a 25 amino acid signal sequence and a 215 amino acid mature chain with a Ig-like (immunoglobulin-like) domain. CD7 is normally expressed on all T-lymphocytes, NK-cells, pre-B lymphocytes and pleuripotent hematopoietic stem cells. CD7 plays an essential role in T-cell interactions, T-cell/B-cell interaction during early lymphoid development, T- and NK-cell activation and cytokine production. CD7 has been shown to interact with PIK3R1and SECTM1. However, the function of the CD7 protein in the immune system is still largely unknown.