Recombinant Human Alpha 1-Microglobulin/AMBP
| Product name: | Recombinant Human Alpha 1-Microglobulin/AMBP |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human alpha 1-Microglobulin is produced by our Mammalian expression system and the target gene encoding Gly20-Val203 is expressed with a 6His tag at the C-terminus. |
| Names | Protein AMBP; Alpha-1-Microglobulin; Protein HC; Alpha-1 Microglycoprotein; Complex-Forming Glycoprotein Heterogeneous in Charge; Inter-Alpha-Trypsin Inhibitor Light Chain; ITI-LC; Bikunin; EDC1; HI-30; Uronic-Acid-Rich Protein; Trypstatin; AMBP; HCP; ITIL |
| Accession # | P02760 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTST RWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAK LYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVVDHHHHHH
|
| Background | Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: α-1-microglobulin, inter-α-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. α-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-α-trypsin inhibitor is present in the plasma and urine. α-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-α-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells. |












