Recombinant Human IL-27 Ra/WSX-1/TCCR

Instruction Manual!

Product name:	Recombinant Human IL-27 Ra/WSX-1/TCCR
Source:	Human Cells
Purity:	Greater than 90% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Interleukin-27 Receptor Subunit α/IL-27Rα is produced by our Mammalian expression system and the target gene encoding Gly34-Lys516 is expressed with a Fc tag at the C-terminus.
Names	class I cytokine receptor; CRL1;IL-27R;IL-27 R alpha;IL-27Ra; IL-27R-alpha; interleukin-27 receptor subunit alpha; TCCR; T-cell cytokine receptor type 1; Type I T-cell cytokine receptor; WSX-1;IL-27R subunit alpha;
Accession #	Q6UWB1
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	IN STOCK
Purity	Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLT MSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLI CQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQT PPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGITCCCSLIPSGA EWARVSAVNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLEHVVDWARD GDPLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGPTLW RLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDLPWGPCELW VTASTIAGQGPPGPILRLHLPDNTLRWKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGK
Background	Interleukin-27 receptor alpha is also known as WSX 1, TCCR and IL 27 R alpha. IL-27 R alpha belongs to the typeⅠ,group 2 cytokine receptor family . Mature IL 27 R alpha is a type I transmembrane glycoprotein which is consist of a 484 amino acid aa extracellular region, a 21 aa transmembrane segment and a 99 aa cytoplasmic domain. Human IL-27 R alpha extracellular region show 63% aa sequence identity with those of mouse IL 27 R alpha extracellular domain. It is highly expressed in lymphoid tissues such as spleen, lymph nodes and peripheral blood leukocytes. The function of human IL-27 R alpha is to act as the receptor of human IL-27 and to involve in the regulation of Th1-type immune responses. In addition, IL‑27 R alpha is reported to complex with CNTFR alpha and gp130 form a human in receptor on neurons, and to complex with gp130 and IL‑6 R to form a receptor for a p28:CLF heterodimeric cytokine on lymphocytes.