elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Carbonic Anhydrase 10/CA10

Recombinant Human Carbonic Anhydrase 10/CA10 Recombinant Human Carbonic Anhydrase 10/CA10

Instruction Manual!

Product name: Recombinant Human Carbonic Anhydrase 10/CA10
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 25mM Tris, 150mM NaCl, pH 7.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
SourceE.coliDescriptionRecombinant Human Carbonic Anhydrase 10 is produced by our E.coli expression system and the target gene encoding Ala21-Asn300 is expressed with a 6His tag at the N-terminus.NamesCarbonic Anhydrase-Related Protein 10, Carbonic Anhydrase-Related Protein X, CA-RP X, CARP X, Cerebral Protein 15, CA10, Hucep-15, UNQ533/PRO1076Accession #Q9NS85FormulationLyophilized from a 0.2 μm filtered solution of 25mM Tris, 150mM NaCl, pH 7.5.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.Biological ActivityIN STOCK
PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
MNHKVHHHHHHMAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIET SHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSE DSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRD TITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLR LLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNLELQSR
BackgroundCarbonic Anhydrase-Related Protein 10 (CA10) belongs to the Carbonic Anhydrase family of Zinc Metalloenzymes. It is an acatalytic member of the alpha-carbonic anhydrase subgroup. CA10 expression is detected in the adult total brain and almost all parts of the central nervous system, but not in the fetal brain. CA10 catalyze the reversible hydration of carbon dioxide in various biological processes, which is fundamental to many processes such as respiration, renal tubular acidification and bone resorption. It is thought to play a role in the central nervous system, especially in brain development.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese