Recombinant Human Parkinson Juvenile Disease Protein 2/PARK2

Instruction Manual!

Product name:	Recombinant Human Parkinson Juvenile Disease Protein 2/PARK2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl，2mM DTT,20% Glycerol,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Parkinson Juvenile Disease Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Lys387 is expressed with a 6His tag at the C-terminus.
Names	E3 Ubiquitin-Protein Ligase Parkin, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2, PARK2, PRKN
Accession #	O60260-5
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl，2mM DTT,20% Glycerol,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQS IVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKD SPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGE CQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVIC LDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRI LGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTKLEH HHHHH
Background	E3 Ubiquitin-Protein Ligase Parkin (PARK2) belongs to the RBR family and Parkin subfamily. PARK2 is expressed in the heart, testis, skeletal muscle, with high expression levels found in the brain including the substantianigra. PARK2 is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. The mutations of gene encoding this protein will result in Parkinson disease and autosomal recessive juvenile Parkinson disease.