Recombinant Human Thioredoxin Domain-Containing Protein 15/TXNDC15

Instruction Manual!

Product name:	Recombinant Human Thioredoxin Domain-Containing Protein 15/TXNDC15
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human TXNDC15 is produced by our Mammalian expression system and the target gene encoding Val33-Ser321 is expressed with a 6His tag at the C-terminus.
Names	Thioredoxin domain-containing protein 15,C5orf14,UNQ335/PRO534
Accession #	Q96J42
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VEVAEESGRLWSEEQPAHPLQVGAVYLGEEELLHDPMGQDRAAEEANAVLGLDTQGDHMVMLSVI PGEAEDKVSSEPSGVTCGAGGAEDSRCNVRESLFSLDGAGAHFPDREEEYYTEPEVAESDAAPTE DSNNTESLKSPKVNCEERNITGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSASLA PHFNSLPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIF NQTGIEAKKNVVVTQADQIGPLPSTLIKSVDHHHHHH
Background	TXNDC15, which is short for oredoxin domain-containing protein 15, is encoded by FAM172A gene. It is also known as C5orf14. TXNDC15 is a 360 aa. protein, and has 2 isoforms produced by alternative splicing. There is a natural variant location which is S248P and it has a 18 aa. signal peptide. TXNDC15 contains 1 thioredoxin domain. This protein is a Single-pass type I membrane protein and locates at membrane.