Recombinant Human Prostate-Specific Antigen//PSA/KLK3

Instruction Manual!

Product name:	Recombinant Human Prostate-Specific Antigen//PSA/KLK3
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHcl, 150mM NaCl,1mM CaCl2,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human KLK3 is produced by our Mammalian expression system and the target gene encoding Ile25-Pro261 is expressed with a 6His tag at the C-terminus.
Names	Prostate-specific antigen，PSA，Gamma-seminoprotein，Kallikrein-3，P-30 antigen，Semenogelase，KLK3，APS
Accession #	P07288
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHcl, 150mM NaCl,1mM CaCl2,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQV FQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYA SGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVC NGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPVDHHHHHH
Background	KLK3, also known as APS, is short for Prostate-specific antigen. It is a 261 aa. protein which belongs to the peptidase S1 family and Kallikrein subfamily. This protein has 5 isforms produced by alternative splicing. It is a secreted protein and can forms a heterodimer with SERPINA5 which can inhibit its activity. KLK3 is also strongly inhibited by Zn2+, 100 times more abundant in semen than in serum. This inhibition is relieved by exposure to semenogelins, which are avid zinc binders. KLK3 can hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.