Recombinant Human Neuronal Acetylcholine Receptor Subunit β-3/CHRNB3

Instruction Manual!

Product name:	Recombinant Human Neuronal Acetylcholine Receptor Subunit β-3/CHRNB3
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CHRNB3 is produced by our Mammalian expression system and the target gene encoding Ile25-Leu232 is expressed with a 6His tag at the C-terminus.
Names	Neuronal acetylcholine receptor subunit beta-3
Accession #	Q05901
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHK LRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCT MDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYS YPFITYSFVLRRLLDHHHHHH
Background	Neuronal acetylcholine receptor subunit beta-3(CHRNB3) is a cell membrane protein and belongs to the ligand-gated ion channel (TC 1.A.9) family. CHRNB3 seems to be composed of two different type of subunits: alpha and beta. The CHRNB3 are (hetero) pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of CHRNB3 are encoded by separate genes and have different primary structure. There are several subtypes of neuronal CHRNB3 that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if like muscle alpha-1, they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits.