Recombinant Human PAPS Synthase 1/PAPSS1

Instruction Manual!

Product name:	Recombinant Human PAPS Synthase 1/PAPSS1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl buffer (pH 8.0), 100mM NaCl and 20% glycerol.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human PAPS synthase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ala624 is expressed with a 6His tag at the C-terminus.
Names	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1,PAPS synthase 1,PAPSS 1,Sulfurylase kinase 1,SK 1,ATPSK1, PAPSS
Accession #	O43252
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl buffer (pH 8.0), 100mM NaCl and 20% glycerol.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MEIPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGK TTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITS FISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKP EAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKIN KVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTA FALMYEGRRVAILRNPEFFEHRKEERCARQWGTTCKNHPYIKMVMEQGDWLIGGDLQVLDRVYWN DGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLG GWTKDDDVPLMWRMKQHAAVLEEGVLNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIV GRDPAGMPHPETGKDLYEPSHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEF ISGTRMRKLAREGQKPPEGFMAPKAWTVLTEYYKSLEKAVDHHHHHH
Background	PAPSS1 is a bifunctional enzyme with both ATP sulfurylase and APS kinase activity. In the N-terminal section, it belongs to the APS kinase family; while the C-terminal section belongs to the sulfate adenylyltransferase family. PAPSS1 can be inhibited by chlorate, and is expressed in many tissues, such as high endothelial venules (HEV) cells and in cartilage. PAPSS1 mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the second step is the transfer of a phosphate group from ATP to APS yielding 3'-phosphoadenylylsulfate. In mammals, PAPS is the sole source of sulfate; APS appears to be only an intermediate in the sulfate-activation pathway. PAPSS1 also involved in the biosynthesis of sulfated L-selectin ligands in endothelial cells.