Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10/HSD17B10

Instruction Manual!

Product name:	Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10/HSD17B10
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Trsi HCL pH-8,0.1M NaCl,1mM DTT & 10% glycerol.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human HSD17B10 is produced by our Mammalian expression system and the target gene encoding Met1-Pro261 is expressed with a 6His tag at the C-terminus.
Names	3-hydroxyacyl-CoA dehydrogenase type-2,17-beta-hydroxysteroid dehydrogenase 10,17-beta-HSD 10,3-hydroxy-2-methylbutyryl-CoA dehydrogenase,3-hydroxyacyl-CoA dehydrogenase type II,HSD17B10
Accession #	Q99714
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Trsi HCL pH-8,0.1M NaCl,1mM DTT & 10% glycerol.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADV TSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIR LVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMT IAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQ PVDHHHHHH
Background	3-hydroxyacyl-CoA dehydrogenase type-2(HSD17B10) belongs to the short-chain dehydrogenases/reductases (SDR) family. HSD17B10 is ubiquitously expressed in normal tissues but is overexpressed in neurons affected in AD. It functions in mitochondrial tRNA maturation. It catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. It also catalyzes the third step in the beta-oxidation of fatty acids and carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. The protein exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. By interacting with intracellular amyloid-beta, HSD17B10 may contribute to the neuronal dysfunction associated with Alzheimer disease (AD).