Recombinant Human Thiamin Pyrophosphokinase 1/TPK1

Instruction Manual!

Product name:	Recombinant Human Thiamin Pyrophosphokinase 1/TPK1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Thiamin pyrophosphokinase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser243 is expressed with a 6His tag at the C-terminus.
Names	Thiamin pyrophosphokinase 1,hTPK1,Placental protein 20,PP20,Thiamine pyrophosphokinase 1,TPK1
Accession #	Q9H3S4
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLP EFINGDFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAG RFDQIMASVNTLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQV TTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKSVDHHHHHH
Background	Thiamin pyrophosphokinase 1 (TPK1), belongs to the thiamine pyrophosphokinase family. TPK1 exists as a homodimer, and is detected in heart, kidney, testis, small intestine and peripheral blood leukocytes, and at very low levels in a variety of tissues. TPK1 can catalyze the phosphorylation of thiamine to thiamine pyrophosphate. It can also catalyze the phosphorylation of pyrithiamine to pyrithiamine pyrophosphate.