elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Linker for Activation of T-Cells Family Member 2/LAT2

Recombinant Human Linker for Activation of T-Cells Family Member 2/LAT2 Recombinant Human Linker for Activation of T-Cells Family Member 2/LAT2

Instruction Manual!

Product name: Recombinant Human Linker for Activation of T-Cells Family Member 2/LAT2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
SourceHuman CellsDescriptionRecombinant Human Non-T cell activation linker is produced by our Mammalian expression system and the target gene encoding Arg27-Ala243 is expressed with a 6His tag at the C-terminus.NamesLinker for Activation of T-Cells Family Member 2, Linker for Activation of B-Cells, Membrane-Associated Adapter Molecule, Non-T-Cell Activation Linker, Williams-Beuren Syndrome Chromosomal Region 15 Protein, Williams-Beuren Syndrome Chromosomal Region 5 Protein, LAT2, LAB, NTAL, WBS15, WBSCR15, WBSCR5Accession #Q9GZY6FormulationLyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
RCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPA SSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGI GGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMGQLQREASPGPV GSPDEEDGEPDYVNGEVAATEAVDHHHHHH
BackgroundLinker for Activation of T-Cells Family Member 2 (LAT2) is a single-pass type III membrane protein. LAT2 is highly expressed in the spleen, peripheral blood lymphocytes, and germinal centers of lymph nodes. LAT2 is involved in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. It may also be involved in BCR (B-cell antigen receptor)-mediated signaling in B-cells and FCGR1 (high affinity immunoglobulin gamma Fc receptor I)-mediated signaling in myeloid cells. Coupleing activate of these receptors and their associated kinases with distal intracellular events through the recruitment of GRB2.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese