ecombinant Human Secreted and Transmembrane Protein 1/SECTM1/CD7L/K12

Instruction Manual!

Product name:	ecombinant Human Secreted and Transmembrane Protein 1/SECTM1/CD7L/K12
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Secreted and Transmembrane Protein 1 is produced by our Mammalian expression system and the target gene encoding Gln29-Gly145 is expressed with a 6His tag at the C-terminus.
Names	Secreted and Transmembrane Protein 1, Protein K-12, SECTM1, K12
Accession #	Q8WVN6
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQL QVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGVDHHHHHH
Background	Secreted and Transmembrane Protein 1 (SECTM1) is a transmembrane and secreted protein that belongs to the SECTM family. SECTM1 is expressed in a perinuclear Golgi-like pattern. It is detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. SECTM1 is considered to participate in thymocyte signaling and the hematopoietic/immune system processes. It is reported that SECTM1 is a broadly expressed, IFN-γ-inducible molecule, which functions as a potent costimulatory ligand for T cell activation and is synergistic with anti-CD28.