Recombinant Human Clusterin-Like Protein 1/CLUL1

Instruction Manual!

Product name:	Recombinant Human Clusterin-Like Protein 1/CLUL1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Clusterin-Like Protein 1 is produced by our Mammalian expression system and the target gene encoding Ala21-Ala442 is expressed with a 6His tag at the C-terminus.
Names	Clusterin-Like Protein 1, Retinal-Specific Clusterin-Like Protein, CLUL1
Accession #	Q15846
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQ EALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIY QFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQS HFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDL PKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDE AIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHE GNISKQDETMMTDLSILPSSNFTLKIPLEESAVDHHHHHH
Background	Clusterin-Like Protein 1 (CLUL1) is a secreted protein that belongs to the clusterin family. CLUL1 is synthesized as a 466 amino acid precursor that contains a 20 amino acid signal sequence, and a 446 amino acid mature chain. CLUL1 is expressed predominantly by cone photoreceptors of the retina. It has been shown that CLUL1 expression is down-regulated in some forms of retinal disease.