Recombinant Human Lymphocyte Antigen 6H/LY6H

Instruction Manual!

Product name:	Recombinant Human Lymphocyte Antigen 6H/LY6H
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus.
Names	Lymphocyte Antigen 6H, Ly-6H, LY6H
Accession #	O94772
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLM GFINSGILKVDVDCCEKDLCNGAAGLDHHHHHH
Background	Lymphocyte Antigen 6H (LY6H) is a novel member of the LY6 family of glycosylphosphatidylinositol-anchored cell surface glycoproteins. LY6H contains one UPAR/Ly6 domain. Human LY6H is synthesized as a 140 amino acid precursor that contains a 25 amino acid signal sequence, 20 amino acid propeptide that is removed in the mature form, and a 90 amino acid mature chain. LY6H is highly expressed in the brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. It is also found in lower levels in testis, pancreas, small intestine and colon. It has been shown that LY6H may play a role in both the central nervous system and the immune system.