| ELISA kit |
| Clinical diagnosis |
| Trfia |
| ANTIBODIES |
| CLIA kits |
| Proteins |
| New Products |
| > Human |
| > Canine |
| > Bovine |
| > Equine |
| > Fish |
| > Mouse |
| > Rat |
| > Chicken |
| > Porcine |
| > Rabbit |
| > Goat |
| > Simian |
| > General |
| > Cavia |
| > Caprine |
| > Sheep |
| > Cattle |
Recombinant Human CGREF1/CGR11
Instruction Manual!
| Product name: | Recombinant Human CGREF1/CGR11 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM GaCl2,pH7.5. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
SourceHuman CellsDescriptionRecombinant Human CGREF1 is produced by our Mammalian expression system and the target gene encoding Ala20-Ile301 is expressed with a 6His tag at the C-terminus.NamesCell Growth Regulator with EF Hand Domain Protein 1, Cell Growth Regulatory Gene 11 Protein, Hydrophobestin, CGREF1, CGR11Accession #Q99674FormulationLyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM GaCl2,pH7.5.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
APKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYD QSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRH VEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGGQAEA DGDVPGPRGEAEGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGET LESKNTQNDFEVHIVQVENDEIVDHHHHHH
BackgroundCell Growth Regulator with EF Hand Domain Protein 1 (CGREF1) is a secreted calcium ion binding protein. CGREF1 contains two EF-hand domains and both EF-hands are required for function. Human CGREF1 is synthesized as a 301 amino acid precursor that contains a 19 amino acid signal sequence, and a 282 amino acid mature chain. CGREF1 is probably digested extracellularly by an unknown serine protease generating extremely hydrophobic bioactive peptides. CGREF1 mediates cell-cell adhesion in a calcium-dependent manner. In addition, CGREF1 is able to inhibit growth in several cell lines.
