Recombinant Human GDNF Family Receptor α-1/GFRA1
| Product name: | Recombinant Human GDNF Family Receptor α-1/GFRA1 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human GDNF Receptor alpha 1 is produced by our Mammalian expression system and the target gene encoding Asp25-Lys429 is expressed with a Fc tag at the C-terminus. |
| Names | GDNF Family Receptor Alpha-1, GDNF Receptor Alpha-1, GDNFR-Alpha-1, GFR-Alpha-1, RET Ligand 1, TGF-Beta-Related Neurotrophic Factor Receptor 1, GFRA1, GDNFRA, RETL1, TRNR1 |
| Accession # | P56159 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
DRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRC KRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISVEHIPKGNNCLDAAK ACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTER RRQTIVPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAY SGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVW QPAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGN YEKEGLGASSHITTKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
|
| Background | Glial Cell Line-Derived Neurotrophic Factor Family Receptor α-1 (GDNFRα1) is a glycosylphosphatidylinositol (GPI) linked cell surface protein belonging to GDNF-family receptor α subtype which consists of at least four members. GFRα1and GFRα2 are the cognate co-receptor for the neurotrophic factor neurturin mediating the NRTN-induced autophosphorylation and activation of the RET tyrosine kinase receptor. Soluble GFRαs released enzymatically from the cell surface by phosphatidylinositol phospholipase C, as well as recombinantly produced soluble GFRα1, can also bind with high affinity to GDNF and trigger the activation of Ret tyrosine kinase. Human GFRα1 shares 93% amino acid identity with mouse GFRα1.The expression of the various GFRαs are differentially regulated in the central and peripheral nervous system, suggesting complementary roles for the GFRαs in mediating the activities of the GDNF family of neurotrophic factors. |












