Recombinant Human Rho GTPase-Activating Protein 25/ARHGAP25

Instruction Manual!

Product name:	Recombinant Human Rho GTPase-Activating Protein 25/ARHGAP25
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20 mMTrisHCl, pH 7.5,1 mM DTT, 5 mM MgCl2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human ARHGAP25 is produced by our Mammalian expression system and the target gene encoding Met1-Leu458 is expressed with a 6His tag at the C-terminus.
Names	Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25, ARHGAP25, KIAA0053
Accession #	P42331-2
Formulation	Supplied as a 0.2 μm filtered solution of 20 mMTrisHCl, pH 7.5,1 mM DTT, 5 mM MgCl2.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRA QQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQA EMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLP GQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADE AKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVI MRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSF SSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFY WHLVDHHHHHH
Background	Human ARHGAP25, also known as Rho GTPase-activating protein 25, Rho-type GTPase-activating protein 25 and KIAA0053, is a 648 amino acid protein. It contains one PH domain and one Rho-GAP domain. ARHGAP25 encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration. ARHGAP25 is GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.