Recombinant Human GMP Reductase 1/GMPR

Instruction Manual!

Product name:	Recombinant Human GMP Reductase 1/GMPR
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl,40% glycerol,0.15M NaCl and 1mM DTT, pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human GMP Reductase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser345 is expressed with a 6His tag at the C-terminus.
Names	GMP Reductase 1, Guanosine 5'-Monophosphate Oxidoreductase 1, Guanosine Monophosphate Reductase 1, GMPR, GMPR1
Accession #	P36959
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl,40% glycerol,0.15M NaCl and 1mM DTT, pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAA VMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDV ANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVG YPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNG RKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLK ELSRRATFIRVTQQHNTVFSVDHHHHHH
Background	GMP Reductase 1 (GMPR) is a member of the IMPDH/GMPR family. GMPR exists as a homotetramer and catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMP reductase gene expression may be regulated by MITF. At least two different alleles are known.