Recombinant Human Acyl-Coenzyme A Thioesterase 13/ACOT13

Instruction Manual!

Product name:	Recombinant Human Acyl-Coenzyme A Thioesterase 13/ACOT13
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Acyl-Coenzyme A Thioesterase 13 is produced by our Mammalian expression system and the target gene encoding Thr2-Asn140 is expressed with a 6His tag at the C-terminus.
Names	Acyl-Coenzyme A Thioesterase 13, Acyl-CoA Thioesterase 13, Thioesterase Superfamily Member 2, ACOT13, THEM2
Accession #	Q9NPJ3
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	TSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDN ISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQ GRHTKHLGNVDHHHHHH
Background	Acyl-coenzyme A thioesterase 13, also known as Thioesterase superfamily member 2, ACOT13, THEM2 and PNAS-27, is a member of the thioesterase PaaI family. Acyl-CoA thioesterases catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. THEM2 is a cytoplasmic protein and exsis in a homotetramer. THEM2 has been identified as an interacting protein of phosphatidylcholine transfer protein. THEM2 also regulates hepatic lipid and glucose metabolism.