Recombinant Human CEACAM7/CGM2
Product name: | Recombinant Human CEACAM7/CGM2 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human CEACAM7 is produced by our Mammalian expression system and the target gene encoding Thr36-Phe142 is expressed with a 6His tag at the C-terminus. |
Names | Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7, Carcinoembryonic Antigen CGM2, CEACAM7, CGM2 |
Accession # | Q14002 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRE TIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH
|
Background | Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy. |