elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human CEACAM7/CGM2

Recombinant Human CEACAM7/CGM2 Recombinant Human CEACAM7/CGM2

Instruction Manual!

Product name: Recombinant Human CEACAM7/CGM2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human CEACAM7 is produced by our Mammalian expression system and the target gene encoding Thr36-Phe142 is expressed with a 6His tag at the C-terminus.
Names Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7, Carcinoembryonic Antigen CGM2, CEACAM7, CGM2
Accession # Q14002
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRE TIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH
Background Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese