Recombinant Human HDGFRP3/HRP-3/HDGF2

Instruction Manual!

Product name:	Recombinant Human HDGFRP3/HRP-3/HDGF2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM MES,150mM NaCl,pH5.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human HDGFRP3 is produced by our Mammalian expression system and the target gene encoding Met1-Thr203 is expressed with a 6His tag at the C-terminus.
Names	Hepatoma-Derived Growth Factor-Related Protein 3, HRP-3, Hepatoma-Derived Growth Factor 2, HDGF-2, HDGFRP3, HDGF2
Accession #	Q9Y3E1
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM MES,150mM NaCl,pH5.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPY KEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVE EDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSD LQKTSEGTVDHHHHHH
Background	Hepatoma-Derived Growth Factor-Related Protein 3 (HDGFRP3) belongs to the HDGF family. HDGFRP3 can be found in testis, heart, spinal cord and brain. HDGFRP3 localizes to the nucleus and contains one PWWP domain. HDGFRP3 enhances DNA synthesis and may have a role in cell proliferation.