elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Ameloblastin/AMBN

Recombinant Human Ameloblastin/AMBN Recombinant Human Ameloblastin/AMBN

Instruction Manual!

Product name: Recombinant Human Ameloblastin/AMBN
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Ameloblastin is produced by our Mammalian expression system and the target gene encoding Val27-Pro447 is expressed with a 6His tag at the C-terminus.
Names Ameloblastin, AMBN
Accession # Q9NP70
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
VPFFPQQSGTPGMASLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLLPPHSSLPWMRP REHETQQYEYSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQ EGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQGPSLPGLDFADPQGSTIFQIA RLISHGPMPQNKQSPLYPGMLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFPGFGGMR PGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDNLENPAFLTELEPAPHA GLPALPKDDIPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDADMTTSVDFQEEATMDT TMAPNSLQTSMPGNKAQEPEMMHDAWHFQEPVDHHHHHH
Background Ameloblastin (AMBN) is a member of the Ameloblastin family. AMBN is a secreted protein and is specially expressed in ameloblast, localizing to the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel Mutations of this protein may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect. Ameloblastin may play an important role in the formation and mineralization of the enamel matrix. Biochemically, it is classified as an intrinsically disordered protein (IDP). Its biological role remains largely unknown.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese