elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human IL-22 Receptor Subunit α2/IL-22BP/IL-22RA2

Recombinant Human IL-22 Receptor Subunit α2/IL-22BP/IL-22RA2 Recombinant Human IL-22 Receptor Subunit α2/IL-22BP/IL-22RA2

Instruction Manual!

Product name: Recombinant Human IL-22 Receptor Subunit α2/IL-22BP/IL-22RA2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
SourceHuman CellsDescriptionRecombinant Human IL-22 Binding Protein is produced by our Mammalian expression system and the target gene encoding Thr22-Pro231 is expressed with a 6His tag at the C-terminus.NamesInterleukin-22 Receptor Subunit Alpha-2, IL-22 Receptor Subunit Alpha-2, IL-22R-Alpha-2, IL-22RA2, Cytokine Receptor Class-II Member 10, Cytokine Receptor Family 2 Member 10, CRF2-10, Cytokine Receptor Family Type 2 Soluble 1, CRF2-S1, Interleukin-22-Binding Protein, IL-22BP, IL22BP, ZcytoR16, IL22RA2Accession #Q969J5-2FormulationLyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSC DLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNL PYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPML DRRSQRSEERCVEIPVDHHHHHH
BackgroundInterleukin-22 Receptor Subunit α-2 (IL22RA2) belongs to the type II cytokine receptor family. IL22RA2 is a secreted protein and contains three fibronectin type-III domains. IL22RA2 is widely expressed in many tissues. IL22RA2 functions as an IL22 antagonist and may be important in the regulation of inflammatory response. Three alternatively spliced transcript variants encoding distinct isoforms have been described.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese