Recombinant Human β,β-Carotene 15,15'-Monooxygenase/BCMO1/BCDO1

Instruction Manual!

Product name:	Recombinant Human β,β-Carotene 15,15'-Monooxygenase/BCMO1/BCDO1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 50mM Tris HCl,10mM reduced Glutathione,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human beta-Carotene Dioxygenase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Thr547 is expressed with a 6His tag at the C-terminus.
Names	Beta,Beta-Carotene 15,15'-Monooxygenase, Beta-Carotene Dioxygenase 1, BCMO1, BCDO, BCDO1
Accession #	Q9HAY6
Formulation	Lyophilized from a 0.2 μm filtered solution of 50mM Tris HCl,10mM reduced Glutathione,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSFTIRDG EVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMK CGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIVEKGKTK YVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFGVTENYVIFLEQPFRLDILKM ATAYIRSMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTDAMVVFHHVNAYEEDGCIVFDVIA YEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFAVPLHVDKNAEVGTNLIKVASTTATALKEED GQVYCQPEFLYEGLELPRVNYAHNGKQYRYVFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWP AEPLFVPAPGAKDEDDGVILSAIVSTDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITD MDWDTKKQAASEEQRDRASDCHGAPLTVDHHHHHH
Background	β,β-Carotene 15,15'-Monooxygenase (BCMO1) is a member of the carotenoid oxygenase family. BCMO1 is highly expressed in retinal pigment epithelium, it is also expressed in the kidney, testis, liver, brain, small intestine, and colon. BCMO1 is a key enzyme in β-carotene metabolism to vitamin A. BCMO1 catalyzes the oxidative cleavage of β,β-carotene into two retinal molecules. The reaction proceeds in three stages, epoxidation of the 15,15'-double bond, hydration of the double bond leading to ring opening, and oxidative cleavage of the diol formed. Defects in BCMO1 are the cause of autosomal dominant hypercarotenemia and vitamin A deficiency.