Recombinant Human Cysteine-Rich with EGF-Like Domain Protein 2/CRELD2

Instruction Manual!

Product name:	Recombinant Human Cysteine-Rich with EGF-Like Domain Protein 2/CRELD2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,5%Trehalose, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CRELD2 is produced by our Mammalian expression system and the target gene encoding Ala25-Leu321 is expressed with a 6His tag at the C-terminus.
Names	Cysteine-Rich With EGF-Like Domain Protein 2, CRELD2
Accession #	Q6UXH1-2
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,5%Trehalose, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCESSDFE CNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHC SGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEV GWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEDVDECSLAEKTCVRKNENCYNTPGSYV CVCPDGFEETEDACVPPAEAEATEGESPTQLPSREDLVDHHHHHH
Background	Cysteine-Rich with EGF-Like Domain Protein 2 (CRELD2) is a secreted protein that is a member of the CRELD family. Human CRELD2 is synthesized as a 353 amino acid precursor protein with a signal peptide, a highly conserved domain rich in glutamic acid and tryptophan (WE) and EGF-like repeats. CRELD2 is ubiquitously expressed in many tissues. CRELD2 may interact with CHRNA4 and regulate transport of α4-β2 neuronal acetylcholine receptor. In addition, CRELD2 could be a novel mediator in regulating the onset and progression of various ER stress-associated diseases.