Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1/CDK2AP1

Instruction Manual!

Product name:	Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1/CDK2AP1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CDK2AP1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser115 is expressed with a 6His tag at the C-terminus.
Names	Cyclin-Dependent Kinase 2-Associated Protein 1, CDK2-Associated Protein 1, Deleted in Oral Cancer 1, DOC-1, Putative Oral Cancer Suppressor, CDK2AP1, CDKAP1, DOC1
Accession #	O14519
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAE LLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARSVDHHHHHH
Background	Cyclin-Dependent Kinase 2-Associated Protein 1 (CDK2AP1) is a member of the CDK2AP family. The homodimeric structure of CDK2AP1 includes an intrinsically disordered 60-residue N-terminal region and a four-helix bundle dimeric structure with reduced Cys-105 in the C-terminal region. The widely expressed CDK2AP1 protein is the only known specific inhibitor of CDK2, making it an important component of cell cycle regulation during G(1)-to-S phase transition. In addition, CDK2AP1 serves as a regulatory role in DNA replication during S phase of the cell cycle.