Recombinant Human MANSC Domain-Containing Protein 1/MANSC1

Instruction Manual!

Product name:	Recombinant Human MANSC Domain-Containing Protein 1/MANSC1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human MANSC1 is produced by our Mammalian expression system and the target gene encoding Gln27-Leu385 is expressed with a 6His tag at the C-terminus.
Names	MANSC Domain-Containing Protein 1, Loss of Heterozygosity 12 Chromosomal Region 3 Protein, MANSC1, LOH12CR3
Accession #	Q9H8J5
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QNCLKKSLEDVVIDIQSSLSKGIRGNEPIYTSTQEDCINSCCSTKNISGDKACNLMIFDTRKTAR QPNCYLFFCPNEEACPLKPAKGLMSYRIITDFPSLTRNLPSQELPQEDSLLHGQFSQAVTPLAHH HTDYSKPTDISWRDTLSQKFGSSDHLEKLFKMDEASAQLLAYKEKGHSQSSQFSSDQEIAHLLPE NVSALPATVAVASPHTTSATPKPATLLPTNASVTPSGTSQPQLATTAPPVTTVTSQPPTTLISTV FTRAAATLQAMATTAVLTTTFQAPTDSKGSLETIPFTEISNLTLNTGNVYNPTALSMSNVESSTM NKTASWEGREASPGSSSQGSVPENQYGLPFEKWLVDHHHHHH
Background	MANSC domain-containing protein 1(MANSC1) is encoded by MANSC1 gene. MANSC1 is a Single-pass type I membrane protein which contains 1 MANSC domain. It is widely expressed in many tissues and mainly located in membrane.