Recombinant Human Follitropin Subunit β/FSHB

Instruction Manual!

Product name:	Recombinant Human Follitropin Subunit β/FSHB
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human FSHB is produced by our Mammalian expression system and the target gene encoding Asn19-Glu129 is expressed with a 6His tag at the C-terminus.
Names	Follitropin Subunit Beta, Follicle-Stimulating Hormone Beta Subunit, FSH-B, FSH-Beta, Follitropin Beta Chain, FSHB
Accession #	P01225
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPG CAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKEVDHHHHHH
Background	Follitropin Subunit β (FSHB) is a secreted protein that belongs to the glycoprotein hormones subunit β family. The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. FSHB exists in a heterodimer of a common α chain and an unique β chain that confers biological specificity to thyrotropin, lutropin, follitropin, and gonadotropin. FSHB stimulates development of follicle and spermatogenesis in the reproductive organs. Defects in FSHB are a cause of isolated follicle-stimulating hormone deficiency (IFSHD).