Recombinant Human Proline-Rich Acidic Protein 1/PRAP1

Instruction Manual!

Product name:	Recombinant Human Proline-Rich Acidic Protein 1/PRAP1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Proline-Rich Acidic Protein 1 is produced by our Mammalian expression system and the target gene encoding Val21-Gln151 is expressed with a 6His tag at the C-terminus.
Names	Proline-Rich Acidic Protein 1, Epididymis Tissue Protein Li 178, Uterine-Specific Proline-Rich Acidic Protein, PRAP1, UPA
Accession #	Q96NZ9
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPI LPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHP QVDHHHHHH
Background	Proline-rich acidic protein 1, also known as Uterine-specific proline-rich acidic protein, UPA and PRAP1, is a secreted protein. PRAP1 is abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. PRAP1 is up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine. PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells. PRAP1 is suppressed through epigenetic mechanisms involving histone deacetylation and methylation. PRAP1 has been shown to cause cell growth inhibition in cancer cell lines.