Recombinant Human Placental Lactogen/CSH1

Instruction Manual!

Product name:	Recombinant Human Placental Lactogen/CSH1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Placental Lactogen is produced by our Mammalian expression system and the target gene encoding Val27-Phe217 is expressed with a 6His tag at the C-terminus.
Names	Chorionic Somatomammotropin Hormone, Choriomammotropin, Lactogen, Placental Lactogen, PL, CSH1, CSH2
Accession #	P01243
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNME ETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLED GSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGFVDHH HHHH
Background	Chorionic Somatomammotropin Hormone (CSH1) belongs to the Somatotropin/Prolactin family. It is located at the growth hormone locus on chromosome 17. It is produced by cells in the syncytiotrophoblast layer of the placenta only during pregnancy. Although CSH1 does not interact with GHR but only activates PRLR through zinc-induced dimerization. It is expressed mainly in the placenta and utilizes multiple transcription initiation sites. CSH1 plays an important role in stimulating lactation, growth control and metabolism.