Recombinant Human Ephrin A Receptor 7/EphA7

Instruction Manual!

Product name:	Recombinant Human Ephrin A Receptor 7/EphA7
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Ephrin A Receptor 7 is produced by our Mammalian expression system and the target gene encoding Gln28-Ile556 is expressed with a 6His tag at the C-terminus.
Names	Ephrin Type-A Receptor 7, EPH Homology Kinase 3, EHK-3, EPH-Like Kinase 11, EK11, hEK11, EPHA7, EHK3, HEK11
Accession #	Q15375
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISK GNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQ GDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGS EFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSS SQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWS PPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEA VNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYE KDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATA VSSEQNPVIVDHHHHHH
Background	Ephrin Type-A Receptor 7 (EPHA7) is a single-pass type I membrane protein which belongs to the Eph family of transmembrane receptor tyrosine kinases. It contains two fibronectin type-III domains, one protein kinase domain and one SAM (sterile alpha motif) domain. EPHA7 is a receptor for members of the ephrin-A family. Eph receptors are largely expressed throughout the ectoderm, mesoderm, and endoderm of vertebrate embryos. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. EPHA7 is expressed at a substantial level in most human lung cancers. The high expression of EPHA7 protein may participate in the malignancy transformation, invasion progression and metastasis of primary hepatocellular carcinoma. EPHA7 may involve in smoking related lung carcinogenesis.