Recombinant Human Leukocyte Mono Ig-Like Receptor 1/LMIR1/CD300a

Instruction Manual!

Product name:	Recombinant Human Leukocyte Mono Ig-Like Receptor 1/LMIR1/CD300a
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LMIR1 is produced by our Mammalian expression system and the target gene encoding Leu18-Gln178 is expressed with a 6His tag at the C-terminus.
Names	CMRF35-Like Molecule 8, CLM-8, CD300 Antigen-Like Family Member A, CMRF-35-H9, CMRF35-H9, CMRF35-H, IRC1/IRC2, Immunoglobulin Superfamily Member 12, IgSF12, Inhibitory Receptor Protein 60, IRp60, NK Inhibitory Receptor, CD300a, CD300A, CMRF35H, IGSF12
Accession #	Q9UGN4
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPA NLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTA FPPVSSTTLFAVGATHSASIQEETEEVVNSQVDHHHHHH
Background	CD300A is a single-pass type I membrane protein that belongs to the CD300 family. CD300A consists of a 163 amino acid (aa) extracellular domain (ECD) with one Ig-like V- type domain, a 21 amino acid transmembrane segment, and a 98 amino acid cytoplasmic domain with tyrosine residues. CD300A is expressed not only by natural killer (NK) cells but also by T-cell subsets, B-cells, dendritic cells, mast cells, granulocytes and monocytes. CD300A is an inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation.