Recombinant Human Leukocyte Mono Ig-Like Receptor 1/LMIR1/CD300a
Product name: | Recombinant Human Leukocyte Mono Ig-Like Receptor 1/LMIR1/CD300a |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human LMIR1 is produced by our Mammalian expression system and the target gene encoding Leu18-Gln178 is expressed with a 6His tag at the C-terminus. |
Names | CMRF35-Like Molecule 8, CLM-8, CD300 Antigen-Like Family Member A, CMRF-35-H9, CMRF35-H9, CMRF35-H, IRC1/IRC2, Immunoglobulin Superfamily Member 12, IgSF12, Inhibitory Receptor Protein 60, IRp60, NK Inhibitory Receptor, CD300a, CD300A, CMRF35H, IGSF12 |
Accession # | Q9UGN4 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Biological Activity |
IN STOCK |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPA NLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTA FPPVSSTTLFAVGATHSASIQEETEEVVNSQVDHHHHHH
|
Background | CD300A is a single-pass type I membrane protein that belongs to the CD300 family. CD300A consists of a 163 amino acid (aa) extracellular domain (ECD) with one Ig-like V- type domain, a 21 amino acid transmembrane segment, and a 98 amino acid cytoplasmic domain with tyrosine residues. CD300A is expressed not only by natural killer (NK) cells but also by T-cell subsets, B-cells, dendritic cells, mast cells, granulocytes and monocytes. CD300A is an inhibitory receptor which may contribute to the down-regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation. |