Recombinant Human Glioma Pathogenesis-Related Protein 1/GLIPR1/RTVP1

Instruction Manual!

Product name:	Recombinant Human Glioma Pathogenesis-Related Protein 1/GLIPR1/RTVP1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human GLIPR1 is produced by our Mammalian expression system and the target gene encoding Asn22-Arg232 is expressed with a 6His tag at the C-terminus.
Names	Glioma Pathogenesis-Related Protein 1, GliPR 1, Protein RTVP-1, GLIPR1, GLIPR, RTVP1
Accession #	P48060
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPP HKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGC AVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKR YYSVVYPGWPIYPRNRVDHHHHHH
Background	Glioma Pathogenesis-Related Protein 1 (GLIPR1) is a member of the CRISP family. It is a single-pass membrane protein with 266 amino acids. GLIPR1 is highly expressed in the lung and kidney and lowly expressed in the heart and liver. It is also highly expressed in cell lines that are derived from nervous system tumors arising from glia; conversely, it is lowly expressed in non-glial-derived nervous system tumor cell lines. GLIPR1 is only expressed in brain tumor glioblastoma multiforme/astrocytoma and not expressed in other nervous system tumors nor normal adult or fetal tissues.