elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human ST6 Sialyltransferase 2/ST6GalNAc

Recombinant Human ST6 Sialyltransferase 2/ST6GalNAc Recombinant Human ST6 Sialyltransferase 2/ST6GalNAc

Instruction Manual!

Product name: Recombinant Human ST6 Sialyltransferase 2/ST6GalNAc
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human ST6GalNAc2 is produced by our Mammalian expression system and the target gene encoding Ser29-Arg374 is expressed with a 6His tag at the C-terminus.
Names Alpha-N-Acetylgalactosaminide Alpha-2,6-Sialyltransferase 2, GalNAc Alpha-2,6-Sialyltransferase II, ST6GalNAc II, ST6GalNAcII, SThM, Sialyltransferase 7B, SIAT7-B, ST6GALNAC2, SIAT7B, SIATL1, STHM
Accession # Q9UJ37
Formulation Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLW GDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGG ILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQ DLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFL KSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDL SLEAALWRDLHKAGILQLYQR
Background Alpha-N-Acetylgalactosaminide α-2,6-Sialyltransferase 2 (ST6GALNAC2) belongs to the glycosyltransferase 29 family that adds sialic acids to the non-reducing ends of glycoconjugates. At the cell surface, these modifications play roles in cell-cell and cell-substrate interactions, bacterial adhesion and protein targeting. ST6GALNAC2 is localized to the Golgi apparatus membrane. ST6GALNAC2 is highly expressed in lactating mammary glands and the adult testis; it is expressed at lower levels in the kidney. ST6GALNAC2 can catalyze 2,6-sialylation of the Tn antigen.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese