Recombinant Human Secretagoginn/SCGN

Instruction Manual!

Product name:	Recombinant Human Secretagoginn/SCGN
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Secretagogin is produced by our Mammalian expression system and the target gene encoding Met1-Pro276 is expressed with a 6His tag at the C-terminus.
Names	Secretagogin, SCGN, SECRET
Accession #	O76038
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQ FMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAEL RNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACST EERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGK IQKSELALCLGLKINPVDHHHHHH
Background	Secretagogin (SCGN) is a secreted calcium-binding protein that is found in the cytoplasm; a small proportion is associated with secretory granules and membrane fractions. SCGN contains six EF-hand domains, related to calbindin D-28K and calretinin. SCGN is thought to be involved in KCL-stimulated calcium flux and cell proliferation SCGN can be detected in human serum after ischemic neuronal damage. SCGN may function to negatively control growth and differentiation rates and, thus, indirectly inhibit cell replication.