Recombinant Human Leucine-Rich Repeat-Containing Protein 3B/LRRC3B

Instruction Manual!

Product name:	Recombinant Human Leucine-Rich Repeat-Containing Protein 3B/LRRC3B
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LRRC3B is produced by our Mammalian expression system and the target gene encoding Cys34-Tyr204 is expressed with a 6His tag at the C-terminus.
Names	Leucine-Rich Repeat-Containing Protein 3B, Leucine-Rich Repeat Protein LRP15, LRRC3B, LRP15
Accession #	Q96PB8
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKN GIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASN HETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYVDHHHHHH
Background	Leucine-Rich Repeat-Containing Protein 3B (LRRC3B) belongs to the LRRC3 family. LRRC3B is single-pass membrane protein and contains three leucine-rich repeats, one LRRCT domain, and one LRRNT domain. LRR-containing proteins, of which there are greater than 2,000, participate in many important processes, including plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis. A number of microarray expression profiling studies on human cancers have shown that LRRC3B is down-regulated in gastric, breast, colon, testis, prostate and brain cancers, suggesting LRRC3B involvement in carcinogenesis