Recombinant Human Heat Shock Protein β-2//HSPB2/MKBP

Instruction Manual!

Product name:	Recombinant Human Heat Shock Protein β-2//HSPB2/MKBP
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,0.1MKCl,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Heat shock protein beta-2 is produced by our E.coli expression system and the target gene encoding Met1-Pro182 is expressed with a 6His tag at the C-terminus.
Names	Heat shock protein beta-2,HspB2,DMPK-binding protein,MKBP,
Accession #	Q16082
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,0.1MKCl,pH7.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGAS ELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPW RVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEPLEHHHHHH
Background	Heat shock protein beta-2(HSPB2) is a protein that in humans is encoded by the HSPB2 gene. HSPB2 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. It is expressed preferentially in the heart and skeletal muscle. HSPB2 has been shown to interact with TRAF6, HSPB8, Myotonic dystrophy protein kinase and CRYAB. HSPB2 regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function.